Rorc Peptide - N-terminal region
Rorc Peptide - N-terminal region
Product Specifications
Product Name Alternative
Nr1f3, RORgamma, TOR, Thor
UniProt
P51450
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Rorc Rabbit Polyclonal Antibody (orb329909) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
IHC, WB
NCBI Accession Number
NP_035411
Preservative
Lyophilized powder
AA Sequence
VKFGRMSKKQRDSLHAEVQKQLQQQQQQEQVAKTPPAGSRGADTLTYTLG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC472225-100 1x 100 µL
FABP5 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP5-3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-EL-H1603-01 24 Tests
Human VEGFR-2/KDR (Vascular Endothelial Growth Factor Receptor 2) ELISA Kit
Sign In for Pricing
View Details E-EL-H1603-02 48 Tests
Human VEGFR-2/KDR (Vascular Endothelial Growth Factor Receptor 2) ELISA Kit
Sign In for Pricing
View Details E-EL-H1603-03 96 Tests
Human VEGFR-2/KDR (Vascular Endothelial Growth Factor Receptor 2) ELISA Kit
Sign In for Pricing
View Details 