RP11-298P3.3 Peptide - middle region
RP11-298P3.3 Peptide - middle region
Product Specifications
Product Name Alternative
92M18.3, CG005, FLJ36195, FLJ41089, FLJ43077, PFAAP5, RP11-298P3.3
UniProt
Q92802
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RP11-298P3.3 Rabbit Polyclonal Antibody (orb325989) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_149102
Preservative
Lyophilized powder
AA Sequence
TSCSLGVTSDFHFLNERFDRKLKRWEEPKELPAEDSQDLTSTDYRSLELP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400146-100 1x 100 µL
CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680413-100 1x 100 µL
Chromogranin A (CHGA/413), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940902-500 1x 500 µL
Nucleolin (NCL/902), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400532-100 1x 100 µL
Cytokeratin 14 (KRT14/532), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681124-500 1x 500 µL
TOX3 (TOX3/1124), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details