Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXorf66 Peptide - middle region

CXorf66 Peptide - middle region

Product Specifications

Product Name Alternative

LOC347487

UniProt

Q5JRM2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CXorf66 Rabbit Polyclonal Antibody (orb579239) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001013421

Preservative

Lyophilized powder

AA Sequence

PLYSSHPQNEISPSKPFGPQELAKPPKHFNPKRSVSLGRAALLSNSELAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEC14L4 Antibody
MBS7006252-01 0.05 mg

SEC14L4 Antibody

Sign In for Pricing
View Details
SEC14L4 Antibody
MBS7006252-02 0.1 mg

SEC14L4 Antibody

Sign In for Pricing
View Details
SEC14L4 Antibody
MBS7006252-03 5x 0.1 mg

SEC14L4 Antibody

Sign In for Pricing
View Details
CLDN18 Biosimilar Antibody
orb2670042-01 50 µg

CLDN18 Biosimilar Antibody

Sign In for Pricing
View Details
CLDN18 Biosimilar Antibody
orb2670042-02 100 µg

CLDN18 Biosimilar Antibody

Sign In for Pricing
View Details
STX4 (STX4A, Syntaxin-4, Renal Carcinoma Antigen NY-REN-31) (Biotin)
134040-Biotin 100 µL

STX4 (STX4A, Syntaxin-4, Renal Carcinoma Antigen NY-REN-31) (Biotin)

Sign In for Pricing
View Details