Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXorf66 Peptide - middle region

CXorf66 Peptide - middle region

Product Specifications

Product Name Alternative

LOC347487

UniProt

Q5JRM2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CXorf66 Rabbit Polyclonal Antibody (orb579239) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001013421

Preservative

Lyophilized powder

AA Sequence

PLYSSHPQNEISPSKPFGPQELAKPPKHFNPKRSVSLGRAALLSNSELAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trove2 (NM_013835) Mouse Tagged Lenti ORF Clone
MR208604L2 10 µg

Trove2 (NM_013835) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TOR4A Antibody - C-terminal region
ARP68071_P050-25UL 25 µL

TOR4A Antibody - C-terminal region

Sign In for Pricing
View Details
Parp11 Mouse shRNA Lentiviral Particle (Locus ID 101187)
TL509587V 500 µL Each

Parp11 Mouse shRNA Lentiviral Particle (Locus ID 101187)

Sign In for Pricing
View Details
PTPN22
377575 100 µg

PTPN22

Sign In for Pricing
View Details
Recombinant Human GRP78/HSPA5 His Protein
NBP3-18319-100ug 100 µg

Recombinant Human GRP78/HSPA5 His Protein

Sign In for Pricing
View Details
2-Isopropylamino-4’-methylacetophenone, Hydrochloride
I9040-50 2 g

2-Isopropylamino-4’-methylacetophenone, Hydrochloride

Sign In for Pricing
View Details