Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPA2 Peptide - N-terminal region

RPA2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

REPA2, RPA32

UniProt

O76021

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPA2 Rabbit Polyclonal Antibody (orb585353) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056474

Preservative

Lyophilized powder

AA Sequence

GSPAPSQAEKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multi-Well Plates
DP120-SQ-384-N 100 Units/Case

Multi-Well Plates

Sign In for Pricing
View Details
Recombinant Cadherin-17/LI-cadherin/CDH17 Monoclonal Antibody
AN300232P 100 µL

Recombinant Cadherin-17/LI-cadherin/CDH17 Monoclonal Antibody

Sign In for Pricing
View Details
(-)-Valerenic Acid
TRC-V091400-5MG 5 mg

(-)-Valerenic Acid

Sign In for Pricing
View Details
Dowex  1X8 chloride form 100-200 Mesh
TRC-D485515-500G 500 g

Dowex  1X8 chloride form 100-200 Mesh

Sign In for Pricing
View Details
Human FAM72B activation kit by CRISPRa
GA118867 1 Kit

Human FAM72B activation kit by CRISPRa

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD45 Antibody
RD21694F-01 25 µg

PerCP/Cyanine5.5 Anti-Mouse CD45 Antibody

Sign In for Pricing
View Details