RPAIN Peptide - C-terminal region
RPAIN Peptide - C-terminal region
Product Specifications
Product Name Alternative
FLJ25625, FLJ30490, FLJ42429, HRIP, MGC4189, RIP
UniProt
Q86UA6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RPAIN Rabbit Polyclonal Antibody (orb578262) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001028174
Preservative
Lyophilized powder
AA Sequence
VVCQCGLSIPSHSSELTEQKLRACLEGSINEHSAHCPHTPEFSVTGGTEE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881231-500 1x 500 µL
Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740204-500 1x 500 µL
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882302-100 1x 100 µL
MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942035-500 1x 500 µL
ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2035), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details