Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPE Peptide - N-terminal region

RPE Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC2636, RPE2-1

UniProt

Q53TV9

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPE Rabbit Polyclonal Antibody (orb326116) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_008847

Preservative

Lyophilized powder

AA Sequence

ALIKDIRENGMKSCSVTQAEVQWHSQGPLQVGLAIKPGTSVEYLAPWANQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Hepatitis C Virus E2 Antibody
NBP3-12746-50ul 50 µL

Rabbit Polyclonal Hepatitis C Virus E2 Antibody

Sign In for Pricing
View Details
Rho (NM_033441) Rat Tagged Lenti ORF Clone
RR211712L4 10 µg

Rho (NM_033441) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
LY9 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
27828062 1.0 µg DNA

LY9 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rabbit Anti Stella Polyclonal Antibody
CPBT-66158RS 0.1 mg

Rabbit Anti Stella Polyclonal Antibody

Sign In for Pricing
View Details
CD44v9 (Marker of Tumor Metastasis) (rCD44v9/1459), CF740 conjugate, 0.1mg/mL
BNC742345-100 1x 100 µL

CD44v9 (Marker of Tumor Metastasis) (rCD44v9/1459), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MYO1A Protein (N-His, Human)
P506354 100 µg

MYO1A Protein (N-His, Human)

Sign In for Pricing
View Details