Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPE Peptide - N-terminal region

RPE Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC2636, RPE2-1

UniProt

Q53TV9

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPE Rabbit Polyclonal Antibody (orb326116) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_008847

Preservative

Lyophilized powder

AA Sequence

ALIKDIRENGMKSCSVTQAEVQWHSQGPLQVGLAIKPGTSVEYLAPWANQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepatitis Be Ag (HBeAg) (AP)
MBS6126243-01 0.1 mL

Hepatitis Be Ag (HBeAg) (AP)

Sign In for Pricing
View Details
Hepatitis Be Ag (HBeAg) (AP)
MBS6126243-02 5x 0.1 mL

Hepatitis Be Ag (HBeAg) (AP)

Sign In for Pricing
View Details
Gag Antibody
orb843293 2 mg

Gag Antibody

Sign In for Pricing
View Details
4-Nitrophenyl 2-acetamido-2-deoxy-b-D-glucopyranoside
GC8698-1g 1 g

4-Nitrophenyl 2-acetamido-2-deoxy-b-D-glucopyranoside

Sign In for Pricing
View Details
FBXO10 Rabbit Polyclonal Antibody
TA357196 100 µL

FBXO10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HPS3 (Cocoa, Hermansky-Pudlak Syndrome 3 Protein)
MBS6004835-01 0.1 mg

HPS3 (Cocoa, Hermansky-Pudlak Syndrome 3 Protein)

Sign In for Pricing
View Details