Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL10A Peptide - N-terminal region

RPL10A Peptide - N-terminal region

Product Specifications

Product Name Alternative

Csa-19, NEDD6, L10A

UniProt

P62906

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL10A Rabbit Polyclonal Antibody (orb583283) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009035

Preservative

Lyophilized powder

AA Sequence

MSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human APOBEC3F activation kit by CRISPRa
GA116345 1 Kit

Human APOBEC3F activation kit by CRISPRa

Sign In for Pricing
View Details
PTPRS Human Gene Knockout Kit (CRISPR)
KN211163RB 1 Kit

PTPRS Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Allylisopropylacetylurea
TRC-A556600-25MG 25 mg

Allylisopropylacetylurea

Sign In for Pricing
View Details
SCLT1 Human Gene Knockout Kit (CRISPR)
KN418526 1 Kit

SCLT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS505710 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Cfap36 Mouse Gene Knockout Kit (CRISPR)
KN502629 1 Kit

Cfap36 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details