Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL10A Peptide - N-terminal region

RPL10A Peptide - N-terminal region

Product Specifications

Product Name Alternative

Csa-19, NEDD6, L10A

UniProt

P62906

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL10A Rabbit Polyclonal Antibody (orb583283) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009035

Preservative

Lyophilized powder

AA Sequence

MSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF850 activation kit by CRISPRa
GA117545 1 Kit

Human ZNF850 activation kit by CRISPRa

Sign In for Pricing
View Details
Human Histone H1t (HIST1H1T) activation kit by CRISPRa
GA102048 1 Kit

Human Histone H1t (HIST1H1T) activation kit by CRISPRa

Sign In for Pricing
View Details
Sodium 4-Acetylbenzenesulfonate
TRC-S644833-250MG 250 mg

Sodium 4-Acetylbenzenesulfonate

Sign In for Pricing
View Details
Bornyl Acetate (Mixture of Diastereomers)
TRC-B675555-2.5G 2.5 g

Bornyl Acetate (Mixture of Diastereomers)

Sign In for Pricing
View Details
COMP Mouse Monoclonal Antibody [A10H2]
HA601354 100 µL

COMP Mouse Monoclonal Antibody [A10H2]

Sign In for Pricing
View Details
Thrombin Receptor (F2R) Rabbit Polyclonal Antibody
TA376059 100 µL

Thrombin Receptor (F2R) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details