Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL12 Peptide - N-terminal region

RPL12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

L12

UniProt

P30050

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL12 Rabbit Polyclonal Antibody (orb585098) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000967

Preservative

Lyophilized powder

AA Sequence

ATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LYN monoclonal antibody
MB66830-01 50 µL

LYN monoclonal antibody

Sign In for Pricing
View Details
LYN monoclonal antibody
MB66830-02 100 µL

LYN monoclonal antibody

Sign In for Pricing
View Details
P21 Waf1/Cip1 (B-2) Alexa Fluor® 594
sc-271532 AF594 200 µg/mL

P21 Waf1/Cip1 (B-2) Alexa Fluor® 594

Sign In for Pricing
View Details
SIRT2 Antibody
orb621871-01 50 μL

SIRT2 Antibody

Sign In for Pricing
View Details
SIRT2 Antibody
orb621871-02 100 µL

SIRT2 Antibody

Sign In for Pricing
View Details
VAChT monoclonal Guinea pig recombinant IgG
139 308 50 µg

VAChT monoclonal Guinea pig recombinant IgG

Sign In for Pricing
View Details