Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rpl17 Peptide - N-terminal region

Rpl17 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC103289, MGC118163

UniProt

Q9CPR4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rpl17 Rabbit Polyclonal Antibody (orb330826) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001002239

Preservative

Lyophilized powder

AA Sequence

SLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HTRA4 activation kit by CRISPRa
GA116432 1 Kit

Human HTRA4 activation kit by CRISPRa

Sign In for Pricing
View Details
Human CDK2 activation kit by CRISPRa
GA100730 1 Kit

Human CDK2 activation kit by CRISPRa

Sign In for Pricing
View Details
TUT1 Antibody
8C19350-AAT 50 µg

TUT1 Antibody

Sign In for Pricing
View Details
GPR73A (PROKR1) (NM_138964) Human Over-expression Lysate
LC403372 20 µg

GPR73A (PROKR1) (NM_138964) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin 6 Recombinant Rabbit monoclonal Antibody
HA750270 100 µL

Cytokeratin 6 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Mouse Nitric Oxide Synthase 1, Neuronal (NOS1) ELISA Kit
RD-NOS1-Mu-01 96 Tests

Mouse Nitric Oxide Synthase 1, Neuronal (NOS1) ELISA Kit

Sign In for Pricing
View Details