Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rpl17 Peptide - N-terminal region

Rpl17 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC103289, MGC118163

UniProt

Q9CPR4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rpl17 Rabbit Polyclonal Antibody (orb330826) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001002239

Preservative

Lyophilized powder

AA Sequence

SLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GGTLC2 activation kit by CRISPRa
GA114095 1 Kit

Human GGTLC2 activation kit by CRISPRa

Sign In for Pricing
View Details
RCE1 (NM_001032279) Human Over-expression Lysate
LC422291 20 µg

RCE1 (NM_001032279) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human CDK2 Protein (Baculovirus, His Tag)
PKSH031501-01 50 µg

Recombinant Human CDK2 Protein (Baculovirus, His Tag)

Sign In for Pricing
View Details
Recombinant Human CDK2 Protein (Baculovirus, His Tag)
PKSH031501-02 500 µg

Recombinant Human CDK2 Protein (Baculovirus, His Tag)

Sign In for Pricing
View Details
ASH2L Rabbit Polyclonal Antibody
R1408-1 100 µL

ASH2L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Avermectin A1b (>85%)
TRC-A847910-1MG 1 mg

Avermectin A1b (>85%)

Sign In for Pricing
View Details