Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL22 Peptide - C-terminal region

RPL22 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EAP, HBP15, HBP15/L22, L22

UniProt

P35268

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL22 Rabbit Polyclonal Antibody (orb331236) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000974

Preservative

Lyophilized powder

AA Sequence

TSEVPFSKRYLKYLTKKYLKKNNLRDWLRVVANSKESYELRYFQINQDEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FADD Rabbit Polyclonal Antibody
0810-1 100 µL

FADD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1-Oxa-4-azaspiro[5.5]undecan-9-amine HCl Salt
TRC-O477750-50MG 50 mg

1-Oxa-4-azaspiro[5.5]undecan-9-amine HCl Salt

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS705082 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
PSD95 (DLG4) (NM_001365) Human Recombinant Protein
TP315178 20 µg

PSD95 (DLG4) (NM_001365) Human Recombinant Protein

Sign In for Pricing
View Details
ABCA10 Rabbit Polyclonal Antibody
TA371195 100 µL

ABCA10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Brain
CS645099 5x 5 µm

Frozen Tissue Sections, Brain

Sign In for Pricing
View Details