Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL23A Peptide - C-terminal region

RPL23A Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ27455, MDA20, L23A

UniProt

P62750

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL23A Rabbit Polyclonal Antibody (orb585177) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000975

Preservative

Lyophilized powder

AA Sequence

VFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Breast
CS623041 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Sprr4 Mouse Gene Knockout Kit (CRISPR)
KN516666 1 Kit

Sprr4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-Ethenyl-1,3-dihydro-2H-indol-2-one
TRC-E890400-1MG 1 mg

4-Ethenyl-1,3-dihydro-2H-indol-2-one

Sign In for Pricing
View Details
Human ITM2C activation kit by CRISPRa
GA113094 1 Kit

Human ITM2C activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant ANXA1 Antibody
RC-6892-01 50 μL

Recombinant ANXA1 Antibody

Sign In for Pricing
View Details
Recombinant ANXA1 Antibody
RC-6892-02 100 µL

Recombinant ANXA1 Antibody

Sign In for Pricing
View Details