Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL37 Peptide - middle region

RPL37 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp686G1699, MGC99572, L37

UniProt

P61927

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL37 Rabbit Polyclonal Antibody (orb585158) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000988

Preservative

Lyophilized powder

AA Sequence

PAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYRRFRHGFREGTTPKPKRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zmynd8 Rat siRNA Oligo Duplex (Locus ID 296374)
SR512584 1 Kit

Zmynd8 Rat siRNA Oligo Duplex (Locus ID 296374)

Sign In for Pricing
View Details
Recombinant Human Antithrombin-III (SERPINC1) (R294C)
CSB-EP021079HU (M1)-01 20 µg

Recombinant Human Antithrombin-III (SERPINC1) (R294C)

Sign In for Pricing
View Details
Recombinant Human Antithrombin-III (SERPINC1) (R294C)
CSB-EP021079HU (M1)-02 100 µg

Recombinant Human Antithrombin-III (SERPINC1) (R294C)

Sign In for Pricing
View Details
Recombinant Human Antithrombin-III (SERPINC1) (R294C)
CSB-EP021079HU (M1)-03 1 mg

Recombinant Human Antithrombin-III (SERPINC1) (R294C)

Sign In for Pricing
View Details
EFNA1 Antibody
ABD3117 100 µg

EFNA1 Antibody

Sign In for Pricing
View Details
Elafin/Skalp PI3 Mouse Monoclonal Antibody (Fluoro488)
orb3085949 100 µg

Elafin/Skalp PI3 Mouse Monoclonal Antibody (Fluoro488)

Sign In for Pricing
View Details