Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL7 Peptide - N-terminal region

RPL7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC117326, humL7-1, L7

UniProt

P18124

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL7 Rabbit Polyclonal Antibody (orb585071) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000962

Preservative

Lyophilized powder

AA Sequence

KKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKEYRQMYRTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABLIM3 Human Gene Knockout Kit (CRISPR)
KN421800 1 Kit

ABLIM3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
APOBEC1 Rabbit Polyclonal Antibody
TA366899 100 µL

APOBEC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cadherin 16 (CDH16) (NM_004062) Human Over-expression Lysate
LY418245 100 µg

Cadherin 16 (CDH16) (NM_004062) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytochrome P450 2C9 (CYP2C9) (NM_000771) Human Recombinant Protein
TP320997L 1 mg

Cytochrome P450 2C9 (CYP2C9) (NM_000771) Human Recombinant Protein

Sign In for Pricing
View Details
CDX4 Rabbit Polyclonal Antibody
HA500489 100 µL

CDX4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KRTAP13-3 (C-term) Rabbit Polyclonal Antibody
AP52425PU-N 400 µL

KRTAP13-3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details