Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL7A Peptide - C-terminal region

RPL7A Peptide - C-terminal region

Product Specifications

Product Name Alternative

SURF3, TRUP, L7A

UniProt

P62424

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL7A Rabbit Polyclonal Antibody (orb326399) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000963

Preservative

Lyophilized powder

AA Sequence

KLVEAIRTNYNDRYDEIRRHWGGNVLGPKSVARIAKLEKAKAKELATKLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Joint
CS706860 5x 5 µm

Tissue FFPE Sections, Joint

Sign In for Pricing
View Details
Scp2 Mouse Gene Knockout Kit (CRISPR)
KN515398 1 Kit

Scp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Smooth Muscle Actin (1A4), CF405S conjugate, 0.1mg/mL
BNC040665-100 1x 100 µL

Smooth Muscle Actin (1A4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RHOJ Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A9]
TA505468AM 100 µL

RHOJ Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A9]

Sign In for Pricing
View Details
Annexin A1 / (Hairy Cell Leukemia Marker) (6E4/3), Biotin conjugate, 0.1mg/mL
BNCB2179-500 1x 500 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (6E4/3), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Parotid gland
CS500824 5x 5 µm

Frozen Tissue Sections, Parotid gland

Sign In for Pricing
View Details