Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL7A Peptide - C-terminal region

RPL7A Peptide - C-terminal region

Product Specifications

Product Name Alternative

SURF3, TRUP, L7A

UniProt

P62424

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL7A Rabbit Polyclonal Antibody (orb326399) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000963

Preservative

Lyophilized powder

AA Sequence

KLVEAIRTNYNDRYDEIRRHWGGNVLGPKSVARIAKLEKAKAKELATKLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Constitutive androstane receptor (NR1I3) (NM_001077477) Human Over-expression Lysate
LY421432 100 µg

Constitutive androstane receptor (NR1I3) (NM_001077477) Human Over-expression Lysate

Sign In for Pricing
View Details
Cell Meter™ 2-NBDG Glucose Uptake Assay Kit
23500-AAT 200 Tests

Cell Meter™ 2-NBDG Glucose Uptake Assay Kit

Sign In for Pricing
View Details
Alpha 1 microglobuLin (AMBP) (NM_001633) Human Recombinant Protein
TP308342L 1 mg

Alpha 1 microglobuLin (AMBP) (NM_001633) Human Recombinant Protein

Sign In for Pricing
View Details
Ccl5 Mouse Gene Knockout Kit (CRISPR)
KN502795 1 Kit

Ccl5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
STAT4 Human Gene Knockout Kit (CRISPR)
KN206892LP 1 Kit

STAT4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse IGF1 (Long-R3-IGF1) Protein (His Tag)
PKSM041325-01 20 µg

Recombinant Mouse IGF1 (Long-R3-IGF1) Protein (His Tag)

Sign In for Pricing
View Details