Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPP40 Peptide - N-terminal region

RPP40 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RNASEP1, bA428J1.3

UniProt

Q5H9R7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPP40 Rabbit Polyclonal Antibody (orb585313) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001157635

Preservative

Lyophilized powder

AA Sequence

RLREAPRHLLVCEKSNFGNHKSRHRHLVQTHYYNYRVSFLIPECGILSEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100361377 3'UTR GFP Stable Cell Line
TU257927 1.0 mL

LOC100361377 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
MPRD Polyclonal Antibody
UB-GEN-5307 100 µL

MPRD Polyclonal Antibody

Sign In for Pricing
View Details
SLC41A3 Protein Lysate (Rat) with C-HA Tag
44197036 100 µg

SLC41A3 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Sheep Class E basic helix-loop-helix protein 41 (BHLHE41) ELISA Kit
MBS7209816-01 48 Well

Sheep Class E basic helix-loop-helix protein 41 (BHLHE41) ELISA Kit

Sign In for Pricing
View Details
Sheep Class E basic helix-loop-helix protein 41 (BHLHE41) ELISA Kit
MBS7209816-02 96 Well

Sheep Class E basic helix-loop-helix protein 41 (BHLHE41) ELISA Kit

Sign In for Pricing
View Details
Sheep Class E basic helix-loop-helix protein 41 (BHLHE41) ELISA Kit
MBS7209816-03 5x 96 Well

Sheep Class E basic helix-loop-helix protein 41 (BHLHE41) ELISA Kit

Sign In for Pricing
View Details