RPP40 Peptide - N-terminal region
RPP40 Peptide - N-terminal region
Product Specifications
Product Name Alternative
RNASEP1, bA428J1.3
UniProt
Q5H9R7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RPP40 Rabbit Polyclonal Antibody (orb585313) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001157635
Preservative
Lyophilized powder
AA Sequence
RLREAPRHLLVCEKSNFGNHKSRHRHLVQTHYYNYRVSFLIPECGILSEE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
120500D1-AAT 500 Tests
IFluor® 610 Anti-human CD205 Antibody *HD30*
Sign In for Pricing
View Details 
41470111 3x 1.0 µg
RPL34P28 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details CSB-EP008585HU-01 10 µg
Recombinant Human Flap endonuclease 1 (FEN1)
Sign In for Pricing
View Details CSB-EP008585HU-02 50 µg
Recombinant Human Flap endonuclease 1 (FEN1)
Sign In for Pricing
View Details CSB-EP008585HU-03 200 µg
Recombinant Human Flap endonuclease 1 (FEN1)
Sign In for Pricing
View Details