Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPRD1A Peptide - N-terminal region

RPRD1A Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ10656, HsT3101, MGC19513, P15RS

UniProt

Q96P16

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPRD1A Rabbit Polyclonal Antibody (orb585401) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060640

Preservative

Lyophilized powder

AA Sequence

KDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal BHLHE23 Antibody
NBP1-90806 0.1 mL

Rabbit Polyclonal BHLHE23 Antibody

Sign In for Pricing
View Details
2,2'- (5-Amino-1,3-phenylene) bis (2-methylpropanenitrile)
OR1034198 1 g

2,2'- (5-Amino-1,3-phenylene) bis (2-methylpropanenitrile)

Sign In for Pricing
View Details
Anti-Crithidia fasciculata CfPUF5 Antibody, APC Conjugate
DZ41597-APC 200 µL/Vial

Anti-Crithidia fasciculata CfPUF5 Antibody, APC Conjugate

Sign In for Pricing
View Details
Human Vascular Endothelial Growth Factor Receptor 1 (FLT1) ELISA Kit
IHUVEGFR1KT 1 Each

Human Vascular Endothelial Growth Factor Receptor 1 (FLT1) ELISA Kit

Sign In for Pricing
View Details
ZCCHC9 siRNA (Human)
CRJ3371-01 15 nmol

ZCCHC9 siRNA (Human)

Sign In for Pricing
View Details
ZCCHC9 siRNA (Human)
CRJ3371-02 30 nmol

ZCCHC9 siRNA (Human)

Sign In for Pricing
View Details