Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPRD1A Peptide - N-terminal region

RPRD1A Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ10656, HsT3101, MGC19513, P15RS

UniProt

Q96P16

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPRD1A Rabbit Polyclonal Antibody (orb585401) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060640

Preservative

Lyophilized powder

AA Sequence

KDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,1,1-Trifluoroacetone oxime
PC3386-01 1 g

1,1,1-Trifluoroacetone oxime

Sign In for Pricing
View Details
1,1,1-Trifluoroacetone oxime
PC3386-02 5 g

1,1,1-Trifluoroacetone oxime

Sign In for Pricing
View Details
1,1,1-Trifluoroacetone oxime
PC3386-03 25 g

1,1,1-Trifluoroacetone oxime

Sign In for Pricing
View Details
1-Aminoadamantane-d15
SL1039-5 5 mg

1-Aminoadamantane-d15

Sign In for Pricing
View Details
Rabbit anti-FKRP Antibody
MBS4505383-01 0.05 mL

Rabbit anti-FKRP Antibody

Sign In for Pricing
View Details
Rabbit anti-FKRP Antibody
MBS4505383-02 0.1 mL

Rabbit anti-FKRP Antibody

Sign In for Pricing
View Details