Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS13 Peptide - middle region

RPS13 Peptide - middle region

Product Specifications

Product Name Alternative

S13

UniProt

P62277

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPS13 Rabbit Polyclonal Antibody (orb583046) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001008

Preservative

Lyophilized powder

AA Sequence

ILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pinx1 Mouse Gene Knockout Kit (CRISPR)
KN513317 1 Kit

Pinx1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bedaquiline fumarate
FB71553-01 100 mg

Bedaquiline fumarate

Sign In for Pricing
View Details
Bedaquiline fumarate
FB71553-02 250 mg

Bedaquiline fumarate

Sign In for Pricing
View Details
Bedaquiline fumarate
FB71553-03 500 mg

Bedaquiline fumarate

Sign In for Pricing
View Details
Bedaquiline fumarate
FB71553-04 1000 mg

Bedaquiline fumarate

Sign In for Pricing
View Details
Bedaquiline fumarate
FB71553-05 2500 mg

Bedaquiline fumarate

Sign In for Pricing
View Details