Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS2 Peptide - middle region

RPS2 Peptide - middle region

Product Specifications

Product Name Alternative

LLREP3, MGC102851, MGC117344, MGC117345, S2

UniProt

P15880

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPS2 Rabbit Polyclonal Antibody (orb585696) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002943

Preservative

Lyophilized powder

AA Sequence

GASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BBS7 Goat Polyclonal Antibody
AP32056PU-N 100 µg

BBS7 Goat Polyclonal Antibody

Sign In for Pricing
View Details
RBM7 Human Gene Knockout Kit (CRISPR)
KN206461BN 1 Kit

RBM7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytochrome P450 7B1 Antibody
8C12294-AAT 50 µg

Cytochrome P450 7B1 Antibody

Sign In for Pricing
View Details
Bulk Human IgG4 (IB4) Isotype Control S228P
ICH2257S228P-100mg 100 mg

Bulk Human IgG4 (IB4) Isotype Control S228P

Sign In for Pricing
View Details
Twist (TWIST1) (NM_000474) Human Over-expression Lysate
LY424701 100 µg

Twist (TWIST1) (NM_000474) Human Over-expression Lysate

Sign In for Pricing
View Details
Pinacol
TRC-P457300-50G 50 g

Pinacol

Sign In for Pricing
View Details