Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS2 Peptide - middle region

RPS2 Peptide - middle region

Product Specifications

Product Name Alternative

LLREP3, MGC102851, MGC117344, MGC117345, S2

UniProt

P15880

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPS2 Rabbit Polyclonal Antibody (orb585696) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002943

Preservative

Lyophilized powder

AA Sequence

GASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LGALS12 (NM_001142538) Human Over-expression Lysate
LC428159 20 µg

LGALS12 (NM_001142538) Human Over-expression Lysate

Sign In for Pricing
View Details
Human LMTK3 activation kit by CRISPRa
GA114448 1 Kit

Human LMTK3 activation kit by CRISPRa

Sign In for Pricing
View Details
TRAcP (Tartarate Resistant Acid Phosphatase) (ACP5/1070), CF405S conjugate, 0.1mg/mL
BNC041070-100 1x 100 µL

TRAcP (Tartarate Resistant Acid Phosphatase) (ACP5/1070), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ethyl Cyanoacetate
TRC-E905555-5G 5 g

Ethyl Cyanoacetate

Sign In for Pricing
View Details
Helixyte™ Green Fluorimetric ssDNA Quantitation Kit *Optimized for Microplate Readers*
17623-AAT 200 Tests

Helixyte™ Green Fluorimetric ssDNA Quantitation Kit *Optimized for Microplate Readers*

Sign In for Pricing
View Details
Tissue FFPE Sections, Cecum
CS701803 5x 5 µm

Tissue FFPE Sections, Cecum

Sign In for Pricing
View Details