Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS2 Peptide - N-terminal region

RPS2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

LLREP3, MGC102851, MGC117344, MGC117345, S2

UniProt

P15880

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPS2 Rabbit Polyclonal Antibody (orb585697) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002943

Preservative

Lyophilized powder

AA Sequence

RGRGARGGKAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIID

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1QA (Complement C1q Subcomponent Subunit A) (HRP)
124099-HRP 100 µL

C1QA (Complement C1q Subcomponent Subunit A) (HRP)

Sign In for Pricing
View Details
APC6 Rabbit pAb
E47R7832 100 µL

APC6 Rabbit pAb

Sign In for Pricing
View Details
Mouse Cox6a2 activation kit by CRISPRa
GA200842 1 Kit

Mouse Cox6a2 activation kit by CRISPRa

Sign In for Pricing
View Details
TMEM200A Double Nickase Plasmid (h)
sc-407860-NIC 20 µg

TMEM200A Double Nickase Plasmid (h)

Sign In for Pricing
View Details
DPEP2 Antibody - C-terminal region
MBS3215630-01 0.1 mL

DPEP2 Antibody - C-terminal region

Sign In for Pricing
View Details
DPEP2 Antibody - C-terminal region
MBS3215630-02 5x 0.1 mL

DPEP2 Antibody - C-terminal region

Sign In for Pricing
View Details