Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS2 Peptide - N-terminal region

RPS2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

LLREP3, MGC102851, MGC117344, MGC117345, S2

UniProt

P15880

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPS2 Rabbit Polyclonal Antibody (orb585697) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002943

Preservative

Lyophilized powder

AA Sequence

RGRGARGGKAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIID

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hoxa9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3951808 1.0 µg DNA

Hoxa9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Mouse Anti Human Interleukin-2
MBS140003-01 0.5 mg

Mouse Anti Human Interleukin-2

Sign In for Pricing
View Details
Mouse Anti Human Interleukin-2
MBS140003-02 1 mg

Mouse Anti Human Interleukin-2

Sign In for Pricing
View Details
Mouse Anti Human Interleukin-2
MBS140003-03 5x 1 mg

Mouse Anti Human Interleukin-2

Sign In for Pricing
View Details
Rabbit Polyclonal Swine Influenza A H1N1 Hemagglutinin Antibody [DyLight 405]
NBP2-41107V 0.1 mL

Rabbit Polyclonal Swine Influenza A H1N1 Hemagglutinin Antibody [DyLight 405]

Sign In for Pricing
View Details
Recombinant Escherichia coli O17:K52:H18 Cobalamin synthase (cobS)
MBS7012080-01 0.02 mg

Recombinant Escherichia coli O17:K52:H18 Cobalamin synthase (cobS)

Sign In for Pricing
View Details