Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS21 Peptide - middle region

RPS21 Peptide - middle region

Product Specifications

Product Name Alternative

S21

UniProt

P63220

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPS21 Rabbit Polyclonal Antibody (orb583057) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001015

Preservative

Lyophilized powder

AA Sequence

NVAEVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAKADGIVSKNF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P1- (5'-Adenosyl) P3- (5'-adenosyl) triphosphate sodium salt
295378-01 1 mg

P1- (5'-Adenosyl) P3- (5'-adenosyl) triphosphate sodium salt

Sign In for Pricing
View Details
P1- (5'-Adenosyl) P3- (5'-adenosyl) triphosphate sodium salt
295378-02 2 mg

P1- (5'-Adenosyl) P3- (5'-adenosyl) triphosphate sodium salt

Sign In for Pricing
View Details
P1- (5'-Adenosyl) P3- (5'-adenosyl) triphosphate sodium salt
295378-03 5 mg

P1- (5'-Adenosyl) P3- (5'-adenosyl) triphosphate sodium salt

Sign In for Pricing
View Details
CD84 Recombinant Protein C-6His Tag Lyophilized 10ug
IHUCD84RC6HISLY10UG 10 µg

CD84 Recombinant Protein C-6His Tag Lyophilized 10ug

Sign In for Pricing
View Details
FLT3 (Fms-Related Tyrosine Kinase 3, CD135, FLK2, STK1) (Biotin)
MBS6174068-01 0.1 mL

FLT3 (Fms-Related Tyrosine Kinase 3, CD135, FLK2, STK1) (Biotin)

Sign In for Pricing
View Details
FLT3 (Fms-Related Tyrosine Kinase 3, CD135, FLK2, STK1) (Biotin)
MBS6174068-02 5x 0.1 mL

FLT3 (Fms-Related Tyrosine Kinase 3, CD135, FLK2, STK1) (Biotin)

Sign In for Pricing
View Details