RPS21 Peptide - middle region
RPS21 Peptide - middle region
Product Specifications
Product Name Alternative
S21
UniProt
P63220
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RPS21 Rabbit Polyclonal Antibody (orb583057) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001015
Preservative
Lyophilized powder
AA Sequence
NVAEVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAKADGIVSKNF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940770-100 1x 100 µL
Cytokeratin 8/18 (C-43 + DC10), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC683168-100 1x 100 µL
GRP94 / HSP90B1 (Glucose-Regulated Protein 94) (Endoplasmic Reticulum Marker) (HSP90B1/3168R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-BC-K099-S-01 50 Assays (48 samples)
Glutathione Reductase (GR) Activity Assay Kit
Sign In for Pricing
View Details E-BC-K099-S-02 100 Assays (96 samples)
Glutathione Reductase (GR) Activity Assay Kit
Sign In for Pricing
View Details 