Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS6KA4 Peptide - C-terminal region

RPS6KA4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MSK2, RSK-B

UniProt

O75676

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPS6KA4 Rabbit Polyclonal Antibody (orb585452) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001006945

Preservative

Lyophilized powder

AA Sequence

GKREGFFLKSVENAPLAKRRKQKLRSATASRRGSPAPANPGRAPVASKGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPS I and OTC Stable Expressing CHO (CHO-CPS45-22-OTC1-A19) Cell Line
T6178 1x106 cells / 1.0 mL

CPS I and OTC Stable Expressing CHO (CHO-CPS45-22-OTC1-A19) Cell Line

Sign In for Pricing
View Details
NOTCH4 (Notch 4 homolog, Notch 4, Notch homolog-4, Notch homolog 4) (HRP)
301429-HRP 100 µL

NOTCH4 (Notch 4 homolog, Notch 4, Notch homolog-4, Notch homolog 4) (HRP)

Sign In for Pricing
View Details
OSTM1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1576008 1.0 µg DNA

OSTM1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Neurofilament-M Antibody [H7L9]
C19034-50uL 50 μL

Neurofilament-M Antibody [H7L9]

Sign In for Pricing
View Details
CYTB Antibody (Center)
orb40320-01 50 µL

CYTB Antibody (Center)

Sign In for Pricing
View Details
CYTB Antibody (Center)
orb40320-02 100 µL

CYTB Antibody (Center)

Sign In for Pricing
View Details