Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS6KA4 Peptide - C-terminal region

RPS6KA4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MSK2, RSK-B

UniProt

O75676

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPS6KA4 Rabbit Polyclonal Antibody (orb585452) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001006945

Preservative

Lyophilized powder

AA Sequence

GKREGFFLKSVENAPLAKRRKQKLRSATASRRGSPAPANPGRAPVASKGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRFN1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
27587151 3x 1.0 µg DNA

LRFN1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Rat Surf4 Pre-designed siRNA Set B
SI214016B 1 Each

Rat Surf4 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Anti-TMEM30B Antibody Picoband®, Dylight550 Conjugate
A13764-3-Dylight550 100 µg

Anti-TMEM30B Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
Rabbit Ankyrin repeat domain containing protein 57 (ANKRD57) ELISA Kit
GTR10349943 96 Well

Rabbit Ankyrin repeat domain containing protein 57 (ANKRD57) ELISA Kit

Sign In for Pricing
View Details
Cobra poison Protein Rabbit Polyclonal Antibody (Cy7)
orb1055019 100 µL

Cobra poison Protein Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
ZFP38 (ZSCAN21) Mouse Monoclonal Antibody [Clone 3B3]
E45M13716V-2 50 µL

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody [Clone 3B3]

Sign In for Pricing
View Details