Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rpsa Peptide - N-terminal region

Rpsa Peptide - N-terminal region

Product Specifications

Product Name Alternative

67kDa, 67lr, AL022858, Lamr, Lamr1, Lamrl1, MGC117921, MGC118614, MLR, P40, P40-3, P40-8

UniProt

P14206

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rpsa Rabbit Polyclonal Antibody (orb330769) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035159

Preservative

Lyophilized powder

AA Sequence

QMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Formyl Leurosine(>85%)
TRC-F700650-5MG 5 mg

N-Formyl Leurosine(>85%)

Sign In for Pricing
View Details
AMBRA1 Antibody: RPE
SPC-644D-RPE 100 µg

AMBRA1 Antibody: RPE

Sign In for Pricing
View Details
TRIM31 Antibody (Biotin)
KB-13144-01 50 μL

TRIM31 Antibody (Biotin)

Sign In for Pricing
View Details
TRIM31 Antibody (Biotin)
KB-13144-02 100 µL

TRIM31 Antibody (Biotin)

Sign In for Pricing
View Details
TRIM31 Antibody (Biotin)
KB-13144-03 1 mL

TRIM31 Antibody (Biotin)

Sign In for Pricing
View Details
5-(2,2,2-Trifluoroacetyl)-2-thiophenecarboxylic Acid Ethyl Ester
TRC-T789755-2G 2 g

5-(2,2,2-Trifluoroacetyl)-2-thiophenecarboxylic Acid Ethyl Ester

Sign In for Pricing
View Details