Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRAGC Peptide - N-terminal region

RRAGC Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ13311, GTR2, RAGC

UniProt

Q9HB90

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RRAGC Rabbit Polyclonal Antibody (orb583638) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071440

Preservative

Lyophilized powder

AA Sequence

RSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prpsap1 Mouse Gene Knockout Kit (CRISPR)
KN513985 1 Kit

Prpsap1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MPP1 (NM_001166460) Human Over-expression Lysate
LC433103 20 µg

MPP1 (NM_001166460) Human Over-expression Lysate

Sign In for Pricing
View Details
PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2718), CF405S conjugate, 0.1mg/mL
BNC042718-100 1x 100 µL

PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2718), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
malE Mouse Monoclonal Antibody [Clone ID: N128A/4]
75-165 100 µL

malE Mouse Monoclonal Antibody [Clone ID: N128A/4]

Sign In for Pricing
View Details
(1R,6R)-2,8-Diazabicyclo[4.3.0]nonane (Technical Grade)
TRC-D417275-250MG 250 mg

(1R,6R)-2,8-Diazabicyclo[4.3.0]nonane (Technical Grade)

Sign In for Pricing
View Details
CCL16 Polyclonal Antibody
E-AB-16304-01 20 µL

CCL16 Polyclonal Antibody

Sign In for Pricing
View Details