Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRAGC Peptide - N-terminal region

RRAGC Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ13311, GTR2, RAGC

UniProt

Q9HB90

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RRAGC Rabbit Polyclonal Antibody (orb583638) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071440

Preservative

Lyophilized powder

AA Sequence

RSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Micro Centrifuge Tubes
C2000-B 500 Sheets/Pack

Micro Centrifuge Tubes

Sign In for Pricing
View Details
Polystyrene Wang NPC
H10050.1G 1 g

Polystyrene Wang NPC

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/1465), 1mg/mL
BNUM1540-50 1x 50 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/1465), 1mg/mL

Sign In for Pricing
View Details
Gabrb3 Mouse Monoclonal Antibody [Clone ID: N87/25]
75-149 100 µL

Gabrb3 Mouse Monoclonal Antibody [Clone ID: N87/25]

Sign In for Pricing
View Details
TAF9B Human Gene Knockout Kit (CRISPR)
KN417413 1 Kit

TAF9B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HBS1L (NM_001145158) Human Over-expression Lysate
LC428733 20 µg

HBS1L (NM_001145158) Human Over-expression Lysate

Sign In for Pricing
View Details