Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRAGD Peptide - middle region

RRAGD Peptide - middle region

Product Specifications

Product Name Alternative

DKFZP761H171, RAGD, bA11D8.2.1

UniProt

Q9NQL2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RRAGD Rabbit Polyclonal Antibody (orb583605) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067067

Preservative

Lyophilized powder

AA Sequence

CDMIDVVIDISCIYGLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-14-3-3 alpha + beta Mouse mAb
GB12592-50 50 μL

Anti-14-3-3 alpha + beta Mouse mAb

Sign In for Pricing
View Details
ANKRD33B Protein Vector (Human) (pPM-C-HA)
PV062379 500 ng

ANKRD33B Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
3,4-Dihydroxybenzeneacetic acid
orb1302459-01 1 ml x 10 mM (in DMSO)

3,4-Dihydroxybenzeneacetic acid

Sign In for Pricing
View Details
3,4-Dihydroxybenzeneacetic acid
orb1302459-02 500 mg

3,4-Dihydroxybenzeneacetic acid

Sign In for Pricing
View Details
3,4-Dihydroxybenzeneacetic acid
orb1302459-03 1 g

3,4-Dihydroxybenzeneacetic acid

Sign In for Pricing
View Details
Lentiviral mouse Hsf1 shRNA (UAS) - Lentiviral mouse Hsf1 shRNA (UAS) plasmid
GTR15128899 1 Vial

Lentiviral mouse Hsf1 shRNA (UAS) - Lentiviral mouse Hsf1 shRNA (UAS) plasmid

Sign In for Pricing
View Details