RSBN1 Peptide - N-terminal region
RSBN1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
DKFZp781E21150, ROSBIN, RP11-324J2.1
UniProt
Q5VWQ0
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RSBN1 Rabbit Polyclonal Antibody (orb583490) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060834
Preservative
Lyophilized powder
AA Sequence
GGAVGPFKCVFVGEMAAQVGAVRVVRAVAAQEEPDKEGKEKPHAGVSPRG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RDR-PTGS2-Mu-01 96 Tests
Mouse Prostaglandin Endoperoxide Synthase 2 (PTGS2) ELISA Kit
Sign In for Pricing
View Details RDR-PTGS2-Mu-02 48 Tests
Mouse Prostaglandin Endoperoxide Synthase 2 (PTGS2) ELISA Kit
Sign In for Pricing
View Details ![hCG beta (CGB3) Mouse Monoclonal Antibody [Clone ID: SPM105]](https://cdn.genprice.uk/products/937/68dd189e061270361e8fda6e/imageurl/am50098pu-t.webp)
AM50098PU-T 20 µg
hCG beta (CGB3) Mouse Monoclonal Antibody [Clone ID: SPM105]
Sign In for Pricing
View Details 
BNCB1685-100 1x 100 µL
Calponin-1 (Smooth Muscle Marker), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 