Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RSBN1 Peptide - N-terminal region

RSBN1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp781E21150, ROSBIN, RP11-324J2.1

UniProt

Q5VWQ0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RSBN1 Rabbit Polyclonal Antibody (orb583490) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060834

Preservative

Lyophilized powder

AA Sequence

GGAVGPFKCVFVGEMAAQVGAVRVVRAVAAQEEPDKEGKEKPHAGVSPRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KPNB1 Human Gene Knockout Kit (CRISPR)
KN400659 1 Kit

KPNB1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SYDE1 (N-term) Rabbit Polyclonal Antibody
AP54119PU-N 400 µL

SYDE1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2,6-Difluoro-3-formylbenzoic Acid
TRC-D457383-50MG 50 mg

2,6-Difluoro-3-formylbenzoic Acid

Sign In for Pricing
View Details
GABRR2 Polyclonal Antibody
E-AB-90073-01 60 µL

GABRR2 Polyclonal Antibody

Sign In for Pricing
View Details
GABRR2 Polyclonal Antibody
E-AB-90073-02 120 µL

GABRR2 Polyclonal Antibody

Sign In for Pricing
View Details
GABRR2 Polyclonal Antibody
E-AB-90073-03 200 µL

GABRR2 Polyclonal Antibody

Sign In for Pricing
View Details