Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RTP4 Peptide - middle region

RTP4 Peptide - middle region

Product Specifications

Product Name Alternative

IFRG28

UniProt

Q96DX8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RTP4 Rabbit Polyclonal Antibody (orb583633) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071430

Preservative

Lyophilized powder

AA Sequence

SSDSTMRILSNLVQHILKKYYGNGTRKSPEMPVILEVSLEGSHDTANCEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Plek shRNA (UAS) - Lentiviral mouse Plek shRNA (UAS) (100)
GTR15203238 1 Vial

Lentiviral mouse Plek shRNA (UAS) - Lentiviral mouse Plek shRNA (UAS) (100)

Sign In for Pricing
View Details
Human RNASE1 Knockout A549 cell line
GTR15415694 1 Vial

Human RNASE1 Knockout A549 cell line

Sign In for Pricing
View Details
Phospho-Cardiac Troponin I (Ser23 + Ser24) Rabbit Polyclonal Antibody (Cy7)
orb1047264 100 µL

Phospho-Cardiac Troponin I (Ser23 + Ser24) Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Canine Tryptophane ELISA Kit
MBS746527-01 48 Well

Canine Tryptophane ELISA Kit

Sign In for Pricing
View Details
Canine Tryptophane ELISA Kit
MBS746527-02 96 Well

Canine Tryptophane ELISA Kit

Sign In for Pricing
View Details
Canine Tryptophane ELISA Kit
MBS746527-03 5x 96 Well

Canine Tryptophane ELISA Kit

Sign In for Pricing
View Details