Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Runx2 Peptide - C-terminal region

Runx2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cbfa1, OSF-2

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Runx2 Rabbit Polyclonal Antibody (orb573718) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_445922

Preservative

Lyophilized powder

AA Sequence

PCTTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal FGFR2 Antibody (98725) [Janelia Fluor 635]
FAB684JF635 0.1 mL

Mouse Monoclonal FGFR2 Antibody (98725) [Janelia Fluor 635]

Sign In for Pricing
View Details
Lentiviral human NR1H3 sgRNA gene knockout kit - Lentiviral human NR1H3 sgRNA gene knockout kit (25)
GTR15364797 1 Vial

Lentiviral human NR1H3 sgRNA gene knockout kit - Lentiviral human NR1H3 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
CCR2 antagonist 1
T10711-01 100 mg

CCR2 antagonist 1

Sign In for Pricing
View Details
CCR2 antagonist 1
T10711-02 25 mg

CCR2 antagonist 1

Sign In for Pricing
View Details
CCR2 antagonist 1
T10711-03 50 mg

CCR2 antagonist 1

Sign In for Pricing
View Details
Angiotensin Peptide
abx265534-01 5 mg

Angiotensin Peptide

Sign In for Pricing
View Details