Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Runx2 Peptide - C-terminal region

Runx2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cbfa1, OSF-2

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Runx2 Rabbit Polyclonal Antibody (orb573718) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_445922

Preservative

Lyophilized powder

AA Sequence

PCTTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUSP14 AAV Vector (Rat) (CMV)
18675106 1 µg

DUSP14 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Lentiviral mouse Prol1 shRNA (UAS) - Lentiviral mouse Prol1 shRNA (UAS, RFP) plasmid
GTR15262429 1 Vial

Lentiviral mouse Prol1 shRNA (UAS) - Lentiviral mouse Prol1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Goat Anti-Human IgG (H&L) - AF790
L35614 1 mL

Goat Anti-Human IgG (H&L) - AF790

Sign In for Pricing
View Details
Anti-IL15  (2H2)
YF-MA13791 100 ug

Anti-IL15 (2H2)

Sign In for Pricing
View Details
pVgRXR Plasmid
PVTY00633 2 µg

pVgRXR Plasmid

Sign In for Pricing
View Details
Jci 3661
orb1696857-01 25 mg

Jci 3661

Sign In for Pricing
View Details