Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAAL1 Peptide - middle region

SAAL1 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ41463, SPACIA1

UniProt

Q96ER3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SAAL1 Rabbit Polyclonal Antibody (orb581763) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612430

Preservative

Lyophilized powder

AA Sequence

EKLMLEWVRNGAAQPLDQPQEESEEQPVFRLVPCILEAAKQVRSENPEWL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gpx3 3'UTR GFP Stable Cell Line
TU159071 1.0 mL

Gpx3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human 5-taurinomethyluridine-[tRNA] synthase subunit MTO1, mitochondrial (MTO1), Biotinylated
orb3008592-01 20 µg

Recombinant Human 5-taurinomethyluridine-[tRNA] synthase subunit MTO1, mitochondrial (MTO1), Biotinylated

Sign In for Pricing
View Details
Recombinant Human 5-taurinomethyluridine-[tRNA] synthase subunit MTO1, mitochondrial (MTO1), Biotinylated
orb3008592-02 100 µg

Recombinant Human 5-taurinomethyluridine-[tRNA] synthase subunit MTO1, mitochondrial (MTO1), Biotinylated

Sign In for Pricing
View Details
Recombinant Human 5-taurinomethyluridine-[tRNA] synthase subunit MTO1, mitochondrial (MTO1), Biotinylated
orb3008592-03 1 mg

Recombinant Human 5-taurinomethyluridine-[tRNA] synthase subunit MTO1, mitochondrial (MTO1), Biotinylated

Sign In for Pricing
View Details
ANKRD40 Antibody
E38QA6827 100 µL

ANKRD40 Antibody

Sign In for Pricing
View Details
Olr1710 Protein Vector (Rat) (pPM-C-HA)
34161026 500 ng

Olr1710 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details