Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAAL1 Peptide - middle region

SAAL1 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ41463, SPACIA1

UniProt

Q96ER3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SAAL1 Rabbit Polyclonal Antibody (orb581763) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612430

Preservative

Lyophilized powder

AA Sequence

EKLMLEWVRNGAAQPLDQPQEESEEQPVFRLVPCILEAAKQVRSENPEWL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Placental lactogen Polyclonal Antibody, HRP Conjugated
bs-10628R-HRP 100 µL

Placental lactogen Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
mmu-miR-466l-3p miRNA Inhibitor
MIM02119 2x 5.0 nmol

mmu-miR-466l-3p miRNA Inhibitor

Sign In for Pricing
View Details
Olr148 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7399106 1.0 µg DNA

Olr148 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Csde1 (NM_144901) Mouse Untagged Clone
MC202422 10 µg

Csde1 (NM_144901) Mouse Untagged Clone

Sign In for Pricing
View Details
Gigaxonin Lentiviral Activation Particles (h)
sc-407001-LAC 200 µL

Gigaxonin Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
TCR gamma/delta Antibody
orb699838 0.1 mg

TCR gamma/delta Antibody

Sign In for Pricing
View Details