Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAE1 Peptide - N-terminal region

SAE1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AOS1, FLJ3091, HSPC140, SUA1, UBLE1A

UniProt

Q9UBE0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SAE1 Rabbit Polyclonal Antibody (orb330658) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005491

Preservative

Lyophilized powder

AA Sequence

VTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human APRIL/TNFSF13 ELISA Kit (Colorimetric)
NBP1-82419 96 Tests

Human APRIL/TNFSF13 ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
ATP13A2 Antibody (HRP)
orb686177-01 50 μL

ATP13A2 Antibody (HRP)

Sign In for Pricing
View Details
ATP13A2 Antibody (HRP)
orb686177-02 100 µL

ATP13A2 Antibody (HRP)

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS516103 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
AT7519
WGC308122-5mg 5 mg

AT7519

Sign In for Pricing
View Details
Anti-MRPL32 Antibody
A14134-1 100 µL

Anti-MRPL32 Antibody

Sign In for Pricing
View Details