Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAE1 Peptide - N-terminal region

SAE1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AOS1, FLJ3091, HSPC140, SUA1, UBLE1A

UniProt

Q9UBE0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SAE1 Rabbit Polyclonal Antibody (orb330658) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005491

Preservative

Lyophilized powder

AA Sequence

VTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UCN2/Urocortin-2 Rabbit Polyclonal Antibody (BF594)
orb2493214 100 µL

UCN2/Urocortin-2 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Rabbit Polyclonal Caspase-2 CASP2 (1-50) Antibody (Human, Mouse)
B2023582 0.1 mg

Rabbit Polyclonal Caspase-2 CASP2 (1-50) Antibody (Human, Mouse)

Sign In for Pricing
View Details
Camel Dystrobrevin Beta ELISA Kit
MBS086599-01 48 Well

Camel Dystrobrevin Beta ELISA Kit

Sign In for Pricing
View Details
Camel Dystrobrevin Beta ELISA Kit
MBS086599-02 96 Well

Camel Dystrobrevin Beta ELISA Kit

Sign In for Pricing
View Details
Camel Dystrobrevin Beta ELISA Kit
MBS086599-03 5x 96 Well

Camel Dystrobrevin Beta ELISA Kit

Sign In for Pricing
View Details
Camel Dystrobrevin Beta ELISA Kit
MBS086599-04 10x 96 Well

Camel Dystrobrevin Beta ELISA Kit

Sign In for Pricing
View Details