Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAMSN1 Peptide - middle region

SAMSN1 Peptide - middle region

Product Specifications

Product Name Alternative

HACS1, NASH1, SLy2, SASH2, SH3D6B

UniProt

Q9NSI8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SAMSN1 Rabbit Polyclonal Antibody (orb330455) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071419

Preservative

Lyophilized powder

AA Sequence

DISLNKSQLDDCPRDSGCYISSGNSDNGKEDLESENLSDMVHKIIITEPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGR2 Protein Vector (Mouse) (pPB-C-His)
PV174802 500 ng

EGR2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Anti Human CD45 Flow Cytometry Monoclonal Clone HI30 PE/TR Ready To Use 200 Tests
IMSAHUCD45HI30CPETR200 200 Tests

Anti Human CD45 Flow Cytometry Monoclonal Clone HI30 PE/TR Ready To Use 200 Tests

Sign In for Pricing
View Details
TPRN Protein Vector (Human) (pPB-C-His)
PV136782 500 ng

TPRN Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Phospho-mTOR (Ser2481) Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-3495R-BF750-01 20 µL

Phospho-mTOR (Ser2481) Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Phospho-mTOR (Ser2481) Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-3495R-BF750-02 100 µL

Phospho-mTOR (Ser2481) Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
ONECUT2 antibody - N-terminal region
MBS3203735-01 0.1 mL

ONECUT2 antibody - N-terminal region

Sign In for Pricing
View Details