Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP6R1 Peptide - N-terminal region

PPP6R1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KIAA1115, MGC138185, MGC142003, PP6R1, SAP190, SAPS1

UniProt

Q9UPN7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPP6R1 Rabbit Polyclonal Antibody (orb325961) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055746

Preservative

Lyophilized powder

AA Sequence

MFWKFDLHTSSHLDTLLEREDLSLPELLDEEDVLQECKVVNRKLLDFLLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Heat Shock Protein 47 ELISA Kit
MBS735451-01 48 Well

Porcine Heat Shock Protein 47 ELISA Kit

Sign In for Pricing
View Details
Porcine Heat Shock Protein 47 ELISA Kit
MBS735451-02 96 Well

Porcine Heat Shock Protein 47 ELISA Kit

Sign In for Pricing
View Details
Porcine Heat Shock Protein 47 ELISA Kit
MBS735451-03 5x 96 Well

Porcine Heat Shock Protein 47 ELISA Kit

Sign In for Pricing
View Details
Porcine Heat Shock Protein 47 ELISA Kit
MBS735451-04 10x 96 Well

Porcine Heat Shock Protein 47 ELISA Kit

Sign In for Pricing
View Details
Mturn (NM_001289740) Mouse Tagged ORF Clone
MR228016 10 µg

Mturn (NM_001289740) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PIK3R6 Antibody - C-terminal region : HRP (ARP71373_P050-HRP)
ARP71373_P050-HRP 100 µL

PIK3R6 Antibody - C-terminal region : HRP (ARP71373_P050-HRP)

Sign In for Pricing
View Details