Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scamp1 Peptide - N-terminal region

Scamp1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

4930505M11Rik, AI415563, AW122395

UniProt

Q8K021

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Scamp1 Rabbit Polyclonal Antibody (orb584343) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_083429

Preservative

Lyophilized powder

AA Sequence

GSVKMPNVPNTQPAIMKPTEEHPAYTQITKEHALAQAELLKRQEELERKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (DCS-72.F6), CF405S conjugate, 0.1mg/mL
BNC040771-500 1x 500 µL

P27 / KIP1 (DCS-72.F6), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MYL9 Polyclonal Antibody
E-AB-15791-01 20 µL

MYL9 Polyclonal Antibody

Sign In for Pricing
View Details
MYL9 Polyclonal Antibody
E-AB-15791-02 60 µL

MYL9 Polyclonal Antibody

Sign In for Pricing
View Details
MYL9 Polyclonal Antibody
E-AB-15791-03 120 µL

MYL9 Polyclonal Antibody

Sign In for Pricing
View Details
MYL9 Polyclonal Antibody
E-AB-15791-04 200 µL

MYL9 Polyclonal Antibody

Sign In for Pricing
View Details
3'-Bromoacetophenone
TRC-B679363-2.5G 2.5 g

3'-Bromoacetophenone

Sign In for Pricing
View Details