Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scamp1 Peptide - N-terminal region

Scamp1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

4930505M11Rik, AI415563, AW122395

UniProt

Q8K021

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Scamp1 Rabbit Polyclonal Antibody (orb584343) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_083429

Preservative

Lyophilized powder

AA Sequence

GSVKMPNVPNTQPAIMKPTEEHPAYTQITKEHALAQAELLKRQEELERKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin G (CCNG1) Rabbit Polyclonal Antibody
TA374387 100 µL

Cyclin G (CCNG1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/796), 1mg/mL
BNUM1879-50 1x 50 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/796), 1mg/mL

Sign In for Pricing
View Details
RSPO2 Rabbit Polyclonal Antibody
HA500455 100 µL

RSPO2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ESE1 (ELF3) Mouse Monoclonal Antibody [Clone ID: OTI5G5]
CF809974 100 µg

ESE1 (ELF3) Mouse Monoclonal Antibody [Clone ID: OTI5G5]

Sign In for Pricing
View Details
(2S,4R)-4-Aminopyrrolidine-2-carboxylic Acid Dihydrochloride
TRC-A578840-50MG 50 mg

(2S,4R)-4-Aminopyrrolidine-2-carboxylic Acid Dihydrochloride

Sign In for Pricing
View Details
Band 3/AE 1 Antibody
KC-594-01 50 μL

Band 3/AE 1 Antibody

Sign In for Pricing
View Details