SCAMP1 Peptide - middle region
SCAMP1 Peptide - middle region
Product Specifications
Product Name Alternative
SCAMP, SCAMP37
UniProt
P56603
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SCAMP1 Rabbit Polyclonal Antibody (orb584342) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004857
Preservative
Lyophilized powder
AA Sequence
LDRREREMQNLSQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15097274 1 Vial
Lentiviral human RSBN1 shRNA (UAS) - Lentiviral human RSBN1 shRNA (UAS, iRFP) (25)
Sign In for Pricing
View Details 
LV812565 1.0 µg DNA
MGC4836 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 
GTR15082160 1 Vial
Lentiviral human PI16 shRNA (UAS) - Lentiviral human PI16 shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details 245690-HRP 100 µL
ELF3 (E74-like Factor 3 (ets Domain Transcription Factor, Epithelial-Specific), EPR-1, ERT, ESE-1, ESX) (HRP)
Sign In for Pricing
View Details MBS1111183-01 0.02 mg (E-Coli)
Recombinant Microcystis aeruginosa Chromophore lyase CpcT/CpeT 1 (cpcT1)
Sign In for Pricing
View Details